Web Analysis for Lifewaydigitalmarketingagency - lifewaydigitalmarketingagency.net
3.07
Rating by CuteStat
lifewaydigitalmarketingagency.net is 6 years 10 months old. It is a domain having net extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, lifewaydigitalmarketingagency.net is SAFE to browse.
PageSpeed Score
84
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 3 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 138.197.60.71)
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx/1.4.6 (Ubuntu)
Date: Sat, 24 Jun 2017 23:49:54 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: ALLOWALL
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Cache-Control: max-age=0, private, must-revalidate
X-Request-Id: d0c551bf-3514-4342-a635-07ac91f9003e
X-Runtime: 0.044394
Strict-Transport-Security: max-age=31536000
Vary: Origin
Content-Encoding: gzip
Server: nginx/1.4.6 (Ubuntu)
Date: Sat, 24 Jun 2017 23:49:54 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: ALLOWALL
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Cache-Control: max-age=0, private, must-revalidate
X-Request-Id: d0c551bf-3514-4342-a635-07ac91f9003e
X-Runtime: 0.044394
Strict-Transport-Security: max-age=31536000
Vary: Origin
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns1.registrar-servers.com | 156.154.132.200 | United States of America | |
dns2.registrar-servers.com | 156.154.133.200 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
lifewaydigitalmarketingagency.net | A | 1789 |
IP: 138.197.60.71 |
lifewaydigitalmarketingagency.net | NS | 1799 |
Target: dns1.registrar-servers.com |
lifewaydigitalmarketingagency.net | NS | 1799 |
Target: dns2.registrar-servers.com |
lifewaydigitalmarketingagency.net | SOA | 3600 |
MNAME: dns1.registrar-servers.com RNAME: hostmaster.registrar-servers.com Serial: 2017062400 Refresh: 43200 Retry: 3600 Expire: 604800 Minimum TTL: 3601 |
lifewaydigitalmarketingagency.net | MX | 1799 |
Priority: 20 Target: eforward5.registrar-servers.com |
lifewaydigitalmarketingagency.net | MX | 1799 |
Priority: 10 Target: eforward1.registrar-servers.com |
lifewaydigitalmarketingagency.net | MX | 1799 |
Priority: 15 Target: eforward4.registrar-servers.com |
lifewaydigitalmarketingagency.net | MX | 1799 |
Priority: 10 Target: eforward3.registrar-servers.com |
lifewaydigitalmarketingagency.net | MX | 1799 |
Priority: 10 Target: eforward2.registrar-servers.com |
lifewaydigitalmarketingagency.net | TXT | 1799 |
TXT: v=spf1 include:spf.efwd.registrar-servers.com ~all |
Full WHOIS Lookup
Domain name: lifewaydigitalmarketingagency.net
Registry Domain ID: 2136419932_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-06-23T17:30:31.00Z
Creation Date: 2017-06-23T17:30:29.00Z
Registrar Registration Expiration Date: 2018-06-23T17:30:29.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-06-24T14:50:01.04Z
Registry Domain ID: 2136419932_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-06-23T17:30:31.00Z
Creation Date: 2017-06-23T17:30:29.00Z
Registrar Registration Expiration Date: 2018-06-23T17:30:29.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-06-24T14:50:01.04Z