3.07 Rating by CuteStat

lifewaydigitalmarketingagency.net is 6 years 10 months old. It is a domain having net extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, lifewaydigitalmarketingagency.net is SAFE to browse.

PageSpeed Score
84
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

138.197.60.71

Hosted Country:

United States of America US

Location Latitude:

40.8364

Location Longitude:

-74.1403
Lifeway Digital Marketing Agency

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 3
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 138.197.60.71)

ConversionCopify.com

- conversioncopify.com
Not Applicable $ 8.95

Copy Wonks

- copywonks.com

Content On-Demand

Not Applicable $ 8.95

Gigs Ahoy

- gigsahoy.net

Digital Marketers On-Demand

Not Applicable $ 8.95

Marketer Gigs

- marketergigs.com

Marketing Pros - On Demand

Not Applicable $ 8.95

InspixredMatrix

- isxmx.net

Digital Marketers On-Demand

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.4.6 (Ubuntu)
Date: Sat, 24 Jun 2017 23:49:54 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: ALLOWALL
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Cache-Control: max-age=0, private, must-revalidate
X-Request-Id: d0c551bf-3514-4342-a635-07ac91f9003e
X-Runtime: 0.044394
Strict-Transport-Security: max-age=31536000
Vary: Origin
Content-Encoding: gzip

Domain Information

Domain Registrar: NAMECHEAP INC
Registration Date: Jun 23, 2017, 12:00 AM 6 years 10 months 3 weeks ago
Last Modified: Jun 23, 2017, 12:00 AM 6 years 10 months 3 weeks ago
Expiration Date: Jun 23, 2018, 12:00 AM 5 years 10 months 3 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
dns1.registrar-servers.com 156.154.132.200 United States of America United States of America
dns2.registrar-servers.com 156.154.133.200 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
lifewaydigitalmarketingagency.net A 1789 IP: 138.197.60.71
lifewaydigitalmarketingagency.net NS 1799 Target: dns1.registrar-servers.com
lifewaydigitalmarketingagency.net NS 1799 Target: dns2.registrar-servers.com
lifewaydigitalmarketingagency.net SOA 3600 MNAME: dns1.registrar-servers.com
RNAME: hostmaster.registrar-servers.com
Serial: 2017062400
Refresh: 43200
Retry: 3600
Expire: 604800
Minimum TTL: 3601
lifewaydigitalmarketingagency.net MX 1799 Priority: 20
Target: eforward5.registrar-servers.com
lifewaydigitalmarketingagency.net MX 1799 Priority: 10
Target: eforward1.registrar-servers.com
lifewaydigitalmarketingagency.net MX 1799 Priority: 15
Target: eforward4.registrar-servers.com
lifewaydigitalmarketingagency.net MX 1799 Priority: 10
Target: eforward3.registrar-servers.com
lifewaydigitalmarketingagency.net MX 1799 Priority: 10
Target: eforward2.registrar-servers.com
lifewaydigitalmarketingagency.net TXT 1799 TXT: v=spf1
include:spf.efwd.registrar-servers.com
~all

Full WHOIS Lookup

Domain name: lifewaydigitalmarketingagency.net
Registry Domain ID: 2136419932_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-06-23T17:30:31.00Z
Creation Date: 2017-06-23T17:30:29.00Z
Registrar Registration Expiration Date: 2018-06-23T17:30:29.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: 4e18539758704c728f51ec41f3fd9c7e.protect@whoisguard.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-06-24T14:50:01.04Z